DRAM2_MOUSE   Q9CR48


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CR48

Recommended name:DNA damage-regulated autophagy modulator protein 2

EC number:

Alternative names:(Transmembrane protein 77)

Cleaved into:

GeneID:67171

Gene names  (primary ):Dram2

Gene names  (synonym ):Tmem77

Gene names  (ORF ):

Length:267

Mass:30228

Sequence:MWWFQQGLSFLPSALVIWTFATFIFSYITAITLHHVDPALPYISDTGTIPPERCLFGVMLNIAAVLGIATMYVRYKQVHALNPEENLIIKLNKAGLVLGILSCLGLSLVANFQKSTLFIVHVCGAVLAFSMGSFYMFVQTILSYQMQPKIHSKQVFWVRLLLVIWCGVSALSMMTCSSILYSSDFGPDVVQKLHWNPEDKGYVLHLVTTAAEWSMSFSFFGFFLTYIRDFQKITLRVEANLHGLTLYDTVPCPVNNERTPLLSRDFQ

Tissue specificity:Expressed in the retina. {ECO:0000269|PubMed:25983245}.

Induction:

Developmental stage:

Protein families:DRAM/TMEM150 family


   💬 WhatsApp