F174A_MOUSE   Q9D3L0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9D3L0

Recommended name:Membrane protein FAM174A

EC number:

Alternative names:(Transmembrane protein 157)

Cleaved into:

GeneID:67698

Gene names  (primary ):Fam174a

Gene names  (synonym ):Tmem157

Gene names  (ORF ):

Length:190

Mass:19986

Sequence:MPTPRGCSGPCHFLAPAFVLLLLPALSGSGAVPSMVVREVQESKSPKPGPHTLSPLPPGPTAAQPRGQAQSDAAGLPGAESRNDSIPGAGSEADGLEGKAGEGSQGGSLAVSPSPGDKPMTQRALTVLVVVSAAVLVYFVVRTVRMRRRNRKTRRYGVLDTNIENMELTPLEQDDEDDDNTLFDANHPRR

Tissue specificity:

Induction:

Developmental stage:

Protein families:FAM174 family


   💬 WhatsApp