TIDC1_MOUSE   Q8BUY5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BUY5

Recommended name:Complex I assembly factor TIMMDC1, mitochondrial

EC number:

Alternative names:(Translocase of inner mitochondrial membrane domain-containing protein 1) (TIMM domain containing-protein 1)

Cleaved into:

GeneID:76916

Gene names  (primary ):Timmdc1

Gene names  (synonym ):

Gene names  (ORF ):

Length:285

Mass:31791

Sequence:MGAPPPAPRSRLCGAWGPFPRVFAAGAVAADSPGFVEDREQRSGVSDPGSLESGWDRLRQLFAKDEQQRFSKEIDYIYRAAVSAGIIGWAYGGIPAFIYAKKRYIEQSQAEIYHNRFDAVQSAHRAATRGFIRYGWRWSWRTAVFVTIFNTVNTGLTVYRNKDAMSHFAIAGAVTGGLFRINLGVRGLVAGSIIGALLGAPMGSLLMALEKYSGETVQERRQKEWKALHEQRLEEWRSSLQVTELLPMEIESGLEKIQPEGDAQRIEELLSLPRNPSSPHQQSKH

Tissue specificity:

Induction:

Developmental stage:

Protein families:Tim17/Tim22/Tim23 family


   💬 WhatsApp