TSNAX_MOUSE   Q9QZE7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9QZE7

Recommended name:Translin-associated protein X

EC number:

Alternative names:(Translin-associated factor X)

Cleaved into:

GeneID:53424

Gene names  (primary ):Tsnax

Gene names  (synonym ):Trax

Gene names  (ORF ):

Length:290

Mass:32926

Sequence:MNGKEGPGGFRKRKHDTFPHNQRREGKDASLSSPVMLAFKSFQQELDARHDKYERLVKLSRDITVESKRTIFLLHRITSAPDMEEILTESESKLDGVRQKILQVAQELSGEDMHQFHRAVTTGLQEYVEAVSFQHFIKTRSLISMEEINKQLTFTAEDSGKESKTPPAEGQEKQLVTWRLKLTPVDYLLGVADLTGELMRMCINSVGNGDIDTPFEVSQFLRQVYDGFSFIGNTGPYEVSKKLYTLKQSLAKVENACYALKVRGSEIPKHMLADVFSVKTDMIDQEESIS

Tissue specificity:Detected in heart, brain, lung, liver, kidney and testis. {ECO:0000269|PubMed:10790540}.

Induction:

Developmental stage:

Protein families:Translin family


   💬 WhatsApp