TAF9B_MOUSE   Q6NZA9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6NZA9

Recommended name:Transcription initiation factor TFIID subunit 9B

EC number:

Alternative names:(Transcription initiation factor TFIID subunit 9-like) (Transcription-associated factor TAFII31L)

Cleaved into:

GeneID:407786

Gene names  (primary ):Taf9b

Gene names  (synonym ):Taf9l

Gene names  (ORF ):

Length:249

Mass:27172

Sequence:MEPAKMAPIKNAPRDALVMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKPTVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQKNQTPLPLIKPYAGPRLPPDRYCLTAPNYRLKSLVKKGPNQGRLVPRLSAVSSRPTTPPVAPPQAVSGPNKAATPVSVTSQRFAVQIPPSQSTPAKPAPAATAVQNVLINPSMIGPKNILITTSMVSSQNTATDSNPLKRKHDDDDDNDTM

Tissue specificity:

Induction:

Developmental stage:

Protein families:TAF9 family


   💬 WhatsApp