TCEA3_MOUSE   P23881


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P23881

Recommended name:Transcription elongation factor A protein 3

EC number:

Alternative names:(Transcription elongation factor S-II protein 3) (Transcription elongation factor TFIIS.h)

Cleaved into:

GeneID:21401

Gene names  (primary ):Tcea3

Gene names  (synonym ):Tfiish

Gene names  (ORF ):

Length:347

Mass:38850

Sequence:MGLEEELLRIAKKLEKMVSRKKTEGALDLLKKLNSCQMSIQLLQTTRIGVAVNGVRKHCSDKEVVSLAKVLIKNWKRLLDSPRTTKGEREEREKAKKEKGLGCSDWKPEAGLSPPRKKGGGEPKTRRDSVDSRSSTTSSPKRPSLERSNSSKSKVETPTTPSSPSTPTFAPAVCLLAPCYLTGDSVRDKCVEMLSAALKAEDNFKDYGVNCDKLASEIEDHIYQELKSTDMKYRNRVRSRISNLKDPRNPGLRRNVLSGAISPELIAKMTAEEMASDELRELRNAMTQEAIREHQMAKTGGTTTDLLRCSKCKKKNCTYNQVQTRSADEPMTTFVLCNECGNRWKFC

Tissue specificity:Liver, kidney and heart.

Induction:

Developmental stage:

Protein families:TFS-II family


   💬 WhatsApp