T30A1_MOUSE   Q99J38


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q99J38

Recommended name:Tetratricopeptide repeat protein 30A1

EC number:

Alternative names:(TPR repeat protein 30A1)

Cleaved into:

GeneID:78802

Gene names  (primary ):Ttc30a1

Gene names  (synonym ):

Gene names  (ORF ):

Length:664

Mass:76238

Sequence:MAWQSSSKVPDGEFTAVVYRLIRDSRYSEAVQLLSAELQRSSRSRAGLSLLAYCYYRLQEFELAAECYEQLSQMHPELEQYRLYQAQALYKACLYPEATRVTFLLDNPAYQTRVLRLQAAIKYSEGDLPGARSLVEQLLSGEAGEDSGGENDPDGLVNMGCLLYKEGHYEAACSKFLAALQASGYQPDLSYNLALAYYSSRQYAPALKHIADIIERGIRQHPELGVGMTTEGIDVRSVGNTVVLHQTALIEAFNLKAAIEYQLRNFEVAQETLTDMPPRAEEELDPVTLHNQALMNMDAKPTEGFEKLQFLLQQNPFPPETFGNLLLLYCKYEYFDLAADVLAENAHLTYKFLTPYLYDFLDAMITCQTAPEEAFIKLDGLAGMLTEQLRRLTKQVQEARHNRDDEIIKKAMNEYDETLEKYIPVLMAQAKIYWNLENYPMVEKIFRKSVEFCNDHDVWKLNVAHVLFMQENKYKEAIGFYEPIVKKNYDNILSVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQLSYGDPDKKIYHLCIVNLVIGTLYCAKGNYDFGISRVIKSLEPYHKKLGTDTWYYAKRCFLSLLENMSKHMIVLCDGVVQECVQFLEYCELYGRNIPAVLEQPLEEERIHTGKNTVTYESRLLKALIYEVIGWNM

Tissue specificity:

Induction:

Developmental stage:

Protein families:TTC30/dfy-1/fleer family


   💬 WhatsApp