LST8_MOUSE   Q9DCJ1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9DCJ1

Recommended name:Target of rapamycin complex subunit LST8

EC number:

Alternative names:(TORC subunit LST8) (G protein beta subunit-like) (Protein GbetaL) (Mammalian lethal with SEC13 protein 8) (mLST8)

Cleaved into:

GeneID:56716

Gene names  (primary ):Mlst8

Gene names  (synonym ):Gbl Lst8

Gene names  (ORF ):

Length:326

Mass:35851

Sequence:MNTTPGTVGSDPVILATAGYDHTVRFWQAHSGICTRTVQHQDSQVNALEITPDRSMIAAAGYQHIRMYDLNSNNPNPIISYDGVSKNIASVGFHEDGRWMYTGGEDCTARIWDLRSRNLQCQRIFQVNAPINCVCLHPNQAELIVGDQSGAIHIWDLKTDHNEQLIPEPESSITSAHIDPDASYMAAVNSAGNCYVWNLTGGIGDDVTQLIPKTKIPAHTRYALQCRFSPDSTLLATCSADQTCKIWRTSNFSLMTELSIKSSNPGESSRGWMWGCAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSVLG

Tissue specificity:

Induction:

Developmental stage:

Protein families:WD repeat LST8 family


   💬 WhatsApp