TP8L3_MOUSE   Q3TBL6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q3TBL6

Recommended name:Tumor necrosis factor alpha-induced protein 8-like protein 3

EC number:

Alternative names:(TNF alpha-induced protein 8-like protein 3) (TNFAIP8-like protein 3)

Cleaved into:

GeneID:244882

Gene names  (primary ):Tnfaip8l3

Gene names  (synonym ):

Gene names  (ORF ):

Length:204

Mass:23243

Sequence:MDSDSGEQSEGEPGTAAGPHVFSSKNLALQAQKKILSKIASKTVANMLIDDTSSEIFDELYKVTEIHTHNKKEAHKIMKDAIKVAIKIGILYRNKQFSQEEVIIVEKLRKKLNQTAMTMVSFYEVEYTFDTNVLSKLLHECKDLVHELVQRHLTPRTHGRINHVFNHFADVEFLSTLYGPHGNCRPNLKRICEGINKLLDDKIL

Tissue specificity:Widely expressed (at protein level). {ECO:0000269|PubMed:25242044, ECO:0000269|PubMed:25479791}.

Induction:

Developmental stage:

Protein families:TNFAIP8 family


   💬 WhatsApp