TETN_MOUSE   P43025


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P43025

Recommended name:Tetranectin

EC number:

Alternative names:(TN) (C-type lectin domain family 3 member B) (Plasminogen kringle 4-binding protein)

Cleaved into:

GeneID:

Gene names  (primary ):Clec3b

Gene names  (synonym ):Tna

Gene names  (ORF ):

Length:202

Mass:22257

Sequence:MGFWGTYLLFCLFSFLSQLTAESPTPKAKKAANAKKDLVSSKMFEELKNRMDVLAQEVALLKEKQALQTVCLKGTKVNLKCLLAFTQPKTFHEASEDCISQGGTLGTPQSELENEALFEYARHSVGNDANIWLGLNDMAAEGAWVDMTGGLLAYKNWETEITTQPDGGKAENCAALSGAANGKWFDKRCRDQLPYICQFAIV

Tissue specificity:Highest expression in lung and skeletal muscle.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp