TIRAP_MOUSE   Q99JY1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q99JY1

Recommended name:Toll/interleukin-1 receptor domain-containing adapter protein

EC number:

Alternative names:(TIR domain-containing adapter protein) (Adaptor protein Wyatt) (MyD88 adapter-like protein)

Cleaved into:

GeneID:117149

Gene names  (primary ):Tirap

Gene names  (synonym ):Mal

Gene names  (ORF ):

Length:241

Mass:26035

Sequence:MASSSSVPASSTPSKKPRDKIADWFRQALLKKPKKMPISQESHLYDGSQTATQDGLSPSSCSSPPSHSSPESRSSPSSCSSGMSPTSPPTHVDSSSSSSGRWSKDYDVCVCHSEEDLEAAQELVSYLEGSQASLRCFLQLRDAAPGGAIVSELCQALSRSHCRALLITPGFLRDPWCKYQMLQALTEAPASEGCTIPLLSGLSRAAYPPELRFMYYVDGRGKDGGFYQVKEAVIHYLETLS

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp