TIP39_MOUSE Q91W27
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q91W27
Recommended name：Tuberoinfundibular peptide of 39 residues
EC number：
Alternative names：(TIP39) (Parathyroid hormone 2)
Cleaved into：
GeneID：114640
Gene names (primary )：Pth2
Gene names (synonym )：Tip39 Tipf39
Gene names (ORF )：
Length：100
Mass：11022
Sequence：METCQMSRSPRERLLLLLLLLLLVPWGTGPASGVALPLAGVFSLRAPGRAWAGLGSPLSRRSLALADDAAFRERARLLAALERRRWLDSYMQKLLLLDAP
Tissue specificity：Expressed in testis and, less abundantly, in liver and kidney. Expressed in seminiferous tubuli and several brain regions, including nucleus ruber, caudal paralemniscal nucleus, nucleus centralis pontis, and nucleus subparafascicularis thalami. Expressed in neurons of cerebral cortex and subcortical areas. Expressed in Purkinje cells of cerebellum. {ECO:0000269|PubMed:11818570, ECO:0000269|PubMed:11861531, ECO:0000269|PubMed:12098667}.
Induction：
Developmental stage：
Protein families：Parathyroid hormone family