PDC10_MOUSE   Q8VE70


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8VE70

Recommended name:Programmed cell death protein 10

EC number:

Alternative names:(TF-1 cell apoptosis-related protein 15)

Cleaved into:

GeneID:56426

Gene names  (primary ):Pdcd10

Gene names  (synonym ):Tfar15

Gene names  (ORF ):

Length:212

Mass:24716

Sequence:MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFISANRLIHQTNLILQTFKTVA

Tissue specificity:

Induction:

Developmental stage:

Protein families:PDCD10 family


   💬 WhatsApp