TEX37_MOUSE Q9DAG4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9DAG4
Recommended name：Testis-expressed sequence 37 protein
EC number：
Alternative names：(Testis-specific conserved protein of 21 kDa)
Cleaved into：
GeneID：74221
Gene names (primary )：Tex37
Gene names (synonym )：Tsc21
Gene names (ORF )：
Length：180
Mass：21041
Sequence：MARVVRPQKNHVDLDIYQSSYMVDYKPFGKYKYSRVTPQEQAKLDAQLQSKEFYQPKPNPNPKLEEGYPAFRRPYMTALDLGVPGFFPPQERVTTRKDDGRFTTTCHYAYPASLALYLAQQDPYWLHQRADFPCLMEPERQPAPEVGKGYLLLPGCLCDHHQRVKVPILNRWGPLMPFYQ
Tissue specificity：Only detected after the mouse is 35 days old. Expression increases gradually from day 35 to 6 months, and remains stable after 54 days. Exclusively expressed in the epididymis and testis. Not expressed in other tissues. {ECO:0000269|PubMed:17091336}.
Induction：
Developmental stage：
Protein families：