PRS41_MOUSE Q920S2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q920S2
Recommended name：Serine protease 41
EC number：EC 3.4.21.-
Alternative names：(Testis serine protease 1) (TESSP-1)
Cleaved into：
GeneID：71003
Gene names (primary )：Prss41
Gene names (synonym )：Tessp1
Gene names (ORF )：
Length：322
Mass：36218
Sequence：MGIQGPVLLLLLLCVMLGKPGSREESQAADLKSTDIKLLSMPCGRRNDTRSRIVGGIESMQGRWPWQASLRLKKSHRCGGSLLSRRWVLTAAHCFRKYLDPEKWTVQLGQLTSKPSYWNRKAYSGRYRVKDIIVNSEDKLKSHDLALLRLASSVTYNKDIQPVCVQPSTFTSQHQPRCWVTGWGVLQEDLKPLPPPYHLREVQVSILNNSRCQELFEIFSLHHLITKDVFCAGAEDGSADTCSGDSGGPLVCNMDGLWYQIGIVSWGIGCGRPNLPGIYTNVSHYYNWIETMMILNGAVRRDLALPLLSITLLQAPWLLRPT
Tissue specificity：Testis-specific. Expressed in spermatogonia and spermatocytes. Expressed in Leydig and Sertoli cells (at protein level). Expressed 2 weeks after birth and remains highly expressed in the sexually mature testis. Expressed in the seminiferous tubules but not in the interstitial tissues. Expressed in type B spermatogonia and spermatocytes at stages between preleptotene and pachytene during the spermatogenesis cycle. {ECO:0000269|PubMed:15515062, ECO:0000269|PubMed:19798924}.
Induction：
Developmental stage：
Protein families：Peptidase S1 family