TES_MOUSE P47226
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P47226
Recommended name：Testin
EC number：
Alternative names：(TES1/TES2)
Cleaved into：
GeneID：
Gene names (primary )：Tes
Gene names (synonym )：
Gene names (ORF )：
Length：423
Mass：47983
Sequence：MSATHPTRLGTRTKESNACASQGLVRKPPWANEGEGFELHFWRKICRNCNVVKKSMTVLLSNEEDRKVGRLFEDTKYTTLIAKLKSDGIPMYKRNVMILTNPVAAKKNVSINTVTYEWAPPVQNQALARQYMQMLPKEKQPVAGSEGAQYRKKQLAKQLPAHDQDPSKCHELSPKEVKEMEQFVKKYKSEALGVGDVKFPSEMNAQGDKVHNCGNRHAPAAVASKDKSAESKKTQYSCYCCKHTTNEGEPAIYAERAGYDKLWHPACFICSTCGELLVDMIYFWKNGKLYCGRHYCDSEKPRCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDHILAGKIYVMVTDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTYNNFSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSVECKRMMS
Tissue specificity：Detected at the acrosome of round spermatids (at protein level). Isoform TES1 transcript is highly expressed in adult testis and detected at low levels in other tissues. Isoform TES2 transcript is highly expressed in testis, kidney and spleen; intermediate in thymus, submaxillary gland and lung; detected at low levels in other tissues. {ECO:0000269|PubMed:21278383}.
Induction：
Developmental stage：
Protein families：Prickle / espinas / testin family