T150C_MOUSE Q8C8S3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8C8S3
Recommended name：Transmembrane protein 150C
EC number：
Alternative names：(Tentonin 3)
Cleaved into：
GeneID：231503
Gene names (primary )：Tmem150c
Gene names (synonym )：Ttn3
Gene names (ORF )：
Length：249
Mass：27759
Sequence：MDGKKCSVWMFLPLVFTLFTSAGLWIVYFIAVEDDKILPLNSAARKSGAKHAPYISFAGDDPPASCVFSQVMNMAAFLALVVAVLRFIQLKPKVLNPWLNISGLAALCLASFGMTLLGNFQLTNDEEIHNVGTSLTFGFGTLTCWIQAALTLKVNIKNEGRRAGIPRVILSAVITLCVVLYFILMAQDIHMYAARVQWGLVMCFLAYFGTLAVEFRHYRYEIVCSEYQENFLSFSESLSEASEYQTDQV
Tissue specificity：High expression in the epididymis, pancreas, dorsal-root ganglion, eye, brain, and spinal cord. Expressed in muscle spindle afferents (at protein level)(PubMed:27321926). {ECO:0000269|PubMed:27321926}.
Induction：
Developmental stage：
Protein families：DRAM/TMEM150 family