TBCA_MOUSE   P48428


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P48428

Recommended name:Tubulin-specific chaperone A

EC number:

Alternative names:(TCP1-chaperonin cofactor A) (Tubulin-folding cofactor A) (CFA)

Cleaved into:

GeneID:21371

Gene names  (primary ):Tbca

Gene names  (synonym ):

Gene names  (ORF ):

Length:108

Mass:12758

Sequence:MADPRVRQIKIKTGVVRRLVKERVMYEKEAKQQEEKIEKMKAEDGENYAIKKQAEILQESRMMIPDCQRRLEAAYTDLQQILESEKDLEEAEEYKEARVVLDSVKLEA

Tissue specificity:Widely expressed, but is most abundant in the testis.

Induction:

Developmental stage:

Protein families:TBCA family


   💬 WhatsApp