DRC5_MOUSE   A6H639


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A6H639

Recommended name:Dynein regulatory complex subunit 5

EC number:

Alternative names:(T-complex-associated testis-expressed protein 1) (Tcte-1)

Cleaved into:

GeneID:21645

Gene names  (primary ):Tcte1

Gene names  (synonym ):D17sil1 Drc5

Gene names  (ORF ):

Length:498

Mass:55518

Sequence:MQETPSVPSNSSSHSQSVLTIQRQVSALGSSSTGPTSLKTSSTPTPGQLKTKVPNVRRMRRIISEDAEWSLAIVPLLTELCIQHIVKNFQNNPILKQLPLEHQKKVLSNLPPELPLTVTANLIDDENYWHRCCIKRWSVCHVSRHGGSWKRMFFERHLENLLKLFIPGTTDPNVILDLLPLCRNYVRRIHVDQFLPPVRMPTPLQGEEQSDSGSEGEGSEPEKDHYQLQTLVGGLKHLEELDLVYGVKDCGMNFEWNLFLFTYRDCYSLAATIKACHTLKIFKLTRSKVDDDKARILIRSLLDHPALEELDLSHNLIGDRGARAAAKLLSHSRLRVLNLANNQLQAPGAQSLAHALAHNTNLVFLNLRLNCIEDEGGQAIAHALETNKCLSVLHLGGNKLSEPTATLLSQMLTVNTTLVSLNLSCNHIGQDGGKQLLEGISDNKTILEFDLRLSDVSQESEYLIGQVLHANREAARQRTLNPGHFSSPTNNCTENSVV

Tissue specificity:Testis-specific (at protein level). {ECO:0000269|PubMed:2568335, ECO:0000269|Ref.2}.

Induction:

Developmental stage:

Protein families:DRC5 family


   💬 WhatsApp