CD3E_MOUSE   P22646


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P22646

Recommended name:T-cell surface glycoprotein CD3 epsilon chain

EC number:

Alternative names:(T-cell surface antigen T3/Leu-4 epsilon chain) (CD antigen CD3e)

Cleaved into:

GeneID:12501

Gene names  (primary ):Cd3e

Gene names  (synonym ):

Gene names  (ORF ):

Length:189

Mass:21393

Sequence:MRWNTFWGILCLSLLAVGTCQDDAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVDLTAVAIIIIVDICITLGLLMVIYYWSKNRKAKAKPVTRGTGAGSRPRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRAV

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp