TBX19_MOUSE   Q99ME7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q99ME7

Recommended name:T-box transcription factor TBX19

EC number:

Alternative names:(T-box protein 19) (T-box factor, pituitary)

Cleaved into:

GeneID:83993

Gene names  (primary ):Tbx19

Gene names  (synonym ):Tpit

Gene names  (ORF ):

Length:446

Mass:48037

Sequence:MSELATQKAGEGTVSRLLNVVESELQAGREKGDPTEKQLQIILEDAPLWQRFKEVTNEMIVTKNGRRMFPVLKISVTGLDPNAMYSLLLDFVRTDSHRWKYVNGEWVPAGKPEVSSHSCVYIHPDSPNFGAHWMKAPISFSKVKLTNKLNGGGQIMLNSLHKYEPQVHIVRVGGAHRMVMNCSFPETQFIAVTAYQNEEITALKIKYNPFAKAFLDAKERNHLKDVPEAISESQHVTYSHLGGWILSNPDGVCTAANSNYQYATPLPLPAPHTHHGCEHYAGLRGHRQAPYPSAYMHRNHSPSVNLIESSSNNLQVFSGPDSWTSLSSTPHASILSVPHSNGPINPGPSPYPCLWTISNGGGGPVASGSEVHASTSGTILLGNPAVTSPSSLLPTQATTSAGVEVLGEPSLTSIAVSTWTAVASHPLPGWGGPGGAGRHSSSSLDS

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp