TAA8B_MOUSE   Q5QD06


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5QD06

Recommended name:Trace amine-associated receptor 8b

EC number:

Alternative names:(TaR-8b) (Trace amine receptor 8b) (mTaar8b)

Cleaved into:

GeneID:382348

Gene names  (primary ):Taar8b

Gene names  (synonym ):Gm1149

Gene names  (ORF ):

Length:344

Mass:38006

Sequence:MTSNFSQPALQLCYENTNGSCIKTPYSPGPRVILYMVFGFGAVLAVCGNLLVVISVLHFKQLHSPANFLIASLASADFLVGISVMPFSMVRSIESCWYFGDAFCSLHSCCDVAFCYSSALHLCFISVDRYIAVTDPLVYPTKFTVSVSGICISISWILPLVYSSAVFYTGISAKGIESLVSALNCVGGCQIVVNQDWVLIDFLLFFIPTLVMIILYSKIFLVAKQQAVKIETSVSDNRGESSSESHKARVAKRERKAAKTLGVTVVAFMVSWLPYTIDSLVDAFVGFITPAYVYEICCWSAYYNSAMNPLIYAFFYPWFRKAIKLILSGEILKSHSSTMSLFSE

Tissue specificity:Specifically expressed in neurons of the olfactory epithelium. {ECO:0000269|PubMed:16878137}.

Induction:

Developmental stage:

Protein families:G-protein coupled receptor 1 family


   💬 WhatsApp