TAA7E_MOUSE   Q5QD09


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5QD09

Recommended name:Trace amine-associated receptor 7e

EC number:

Alternative names:(TaR-7e) (Trace amine receptor 7e) (mTaar7e)

Cleaved into:

GeneID:276742

Gene names  (primary ):Taar7e

Gene names  (synonym ):Gm697

Gene names  (ORF ):

Length:358

Mass:40163

Sequence:MATGDDSFLWDQDSILSRDLFSATSAELCYENLNRSCVRSPYSPGPRLILYAVFGFGAVLAVCGNLLVMTSILHFRQLHSPANFLVASLACADFLVGLTVMPFSTVRSVEGCWYFGEIYCKLHTCFDVSFCSSSIFHLCFISVDRYIAVSDPLIYPTRFTASVSNKCITFSWLLSISYGFSLIYTGASEAGLEDLVSALTCVGGCQLAVNQSWVFINFLLFLIPTLVMITVYSKIFLIAKQQAQNIEKMSKQTARASDSYKDRVAKRERKAAKTLGIAVAAFLLSWLPYFIDSFIDAFLGFITPTYVYEILVWIAYYNSAMNPLIYAFFYPWFRKAIKLTVTGKILRENSSTTNLFPE

Tissue specificity:Specifically expressed in neurons of the olfactory epithelium. {ECO:0000269|PubMed:16878137}.

Induction:

Developmental stage:

Protein families:G-protein coupled receptor 1 family


   💬 WhatsApp