TAAR5_MOUSE Q5QD14
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5QD14
Recommended name：Trace amine-associated receptor 5
EC number：
Alternative names：(TaR-5) (Trace amine receptor 5) (mTaar5) (Trimethylamine receptor)
Cleaved into：
GeneID：215854
Gene names (primary )：Taar5
Gene names (synonym )：Gm227
Gene names (ORF )：
Length：337
Mass：38220
Sequence：MRAVLLPGSGEQPTAFCYQVNGSCPRTVHPLAIQVVIYLACAVGVLITVLGNLFVVFAVSYFKVLHTPTNFLLLSLALADMLLGLLVLPLSTVRSVESCWFFGDFLCRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRTALRYIVAGWGIPAAYTAFFLYTDVVERALSQWLEEMPCVGSCQLLFNKFWGWLNFPAFFVPCLIMISLYLKIFVVATRQAQQIRTLSQSLAGAVKRERKAAKTLGIAVGIYLVCWLPFTVDTLVDSLLNFITPPLVFDIFIWFAYFNSACNPIIYVFSYRWFRKALKLLLSREIFSPRTPTVDLYHD
Tissue specificity：Specifically expressed in neurons of the olfactory epithelium, to discrete glomeruli predominantly localized to a confined bulb region. Present in the dorsal area of the main olfactory epithelium. {ECO:0000269|PubMed:16878137, ECO:0000269|PubMed:22837392}.
Induction：
Developmental stage：
Protein families：G-protein coupled receptor 1 family