TAAR1_MOUSE Q923Y8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q923Y8
Recommended name：Trace amine-associated receptor 1
EC number：
Alternative names：(TaR-1) (Trace amine receptor 1)
Cleaved into：
GeneID：111174
Gene names (primary )：Taar1
Gene names (synonym )：Ta1 Tar1 Trar1
Gene names (ORF )：
Length：332
Mass：37621
Sequence：MHLCHAITNISHRNSDWSREVQASLYSLMSLIILATLVGNLIVIISISHFKQLHTPTNWLLHSMAIVDFLLGCLIMPCSMVRTVERCWYFGEILCKVHTSTDIMLSSASIFHLAFISIDRYCAVCDPLRYKAKINISTILVMILVSWSLPAVYAFGMIFLELNLKGVEELYRSQVSDLGGCSPFFSKVSGVLAFMTSFYIPGSVMLFVYYRIYFIAKGQARSINRTNVQVGLEGKSQAPQSKETKAAKTLGIMVGVFLVCWCPFFLCTVLDPFLGYVIPPSLNDALYWFGYLNSALNPMVYAFFYPWFRRALKMVLLGKIFQKDSSRSKLFL
Tissue specificity：Widely distributed throughout the brain. Strongly expressed in the mitral cell layer of the olfactory bulb, piriform cortex, the arcuate, motor, and mesencephalic trigeminal nuclei, lateral reticular and hypoglossal nuclei, cerebellar Purkinje cells, and ventral horn of the spinal cord. Moderately expressed in the frontal, entorhinal, and agranular cortices, the ventral pallidum, thalamus, hippocampus, several hypothalamic nuclei, ambiguus, dorsal raphe, and gigantocellular reticular nuclei. Weakly expressed in the septum, basal ganglia, amygdala, myelencephalon, and spinal cord dorsal horn. Particularly interesting is the moderate expression in several monoaminergic cell groups, namely the dorsal raphe, the locus coeruleus, and the ventral tegmental area.
Induction：
Developmental stage：
Protein families：G-protein coupled receptor 1 family