KCNKD_MOUSE   Q8R1P5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8R1P5

Recommended name:Potassium channel subfamily K member 13

EC number:

Alternative names:(Tandem pore domain halothane-inhibited potassium channel 1) (THIK-1)

Cleaved into:

GeneID:217826

Gene names  (primary ):Kcnk13

Gene names  (synonym ):Gm1570

Gene names  (ORF ):

Length:405

Mass:44926

Sequence:MAGRGCGCSPGHLNEDNARFLLLAGLILLYLLGGAAVFSALELAQELQAKQRWEERLANFSRGHNLSREELRGFLRHYEEATRAGIRMDSVRPRWDFTGAFYFVGTVVSTIGFGMTTPATTGGKIFLIFYGLIGCASTILFFNLFLERLITVIACVMRSCHQQQLRRRGAVTQDNMKAPEKGEADSLTGWKPSVYYVMLILCLASVAISCGASALYTTMEGWSYFDSVYFCFVAFSTIGFGDLVSSQNAQYESQGLYRFFNFFLILMGVCCIYSLFNVISILIKQTVNWILRKLDSGCFPPCQRGLLRSRRNVVMPGNIRNRCNISIETDGVMESDTDGRRLSGEMISMKDTNKVSLAILQKQLSEMANGGPHQNSASSRDDEFSGGVGAFAVMNNRLAETSGDR

Tissue specificity:

Induction:

Developmental stage:

Protein families:Two pore domain potassium channel (TC 1.A.1.8) family


   💬 WhatsApp