TAF5L_MOUSE   Q91WQ5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q91WQ5

Recommended name:TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L

EC number:

Alternative names:(TAF5L) (PCAF-associated factor 65 beta) (PAF65-beta)

Cleaved into:

GeneID:102162

Gene names  (primary ):Taf5l

Gene names  (synonym ):Paf65b

Gene names  (ORF ):

Length:589

Mass:65911

Sequence:MKRVRTEQVQVAVSCYLKRRQYVDSEGPLKQGLRLSQTPEEMAANLTVQSESGCANAVSAAPCQAEPQQYEVQFGRLRSFLTDSDSQYSREVMPLLYPLFVYLHLNLVQSGPKSTVESFYSRFHGMFLQNASQKDVIEQLQTTQTIQDILSNFQLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLAVHIHLDVQPAKRTDYQLYASGGSSRTENSSLEPPEVPSPILQNEAALEVLQESIKRVKDGPPSLTTICFYAFYNTEQLLNTAEISSDSKLLAAGFDNSCIKLWSLRSKKLKSEPHHVDTSRIRLACDTLEEEENEEDNTGTEMKILRGHCGPVYSTRFLADSSGLLSCSEDMSIRYWDLGSFTNTVLYQGHAYPVWDVDISPFSLYFASGSHDRTARLWSFDRTYPLRIYAGHLADVDCVKFHPNSNYLATGSTDKTVRLWSAQQGNSVRLFTGHRGPVLSLSFSPNGKYLASAGEDQRLKLWDLASGTLFKELRGHTDSITSLAFSPDSGLIASASMDNSVRVWDIRSTCCNTPADGSSGELVGVYTGQMSNVLSVQFMACNLLLVTGITQENQEH

Tissue specificity:

Induction:

Developmental stage:

Protein families:WD repeat TAF5 family


   💬 WhatsApp