T2R38_MOUSE   Q7TQA6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q7TQA6

Recommended name:Taste receptor type 2 member 38

EC number:

Alternative names:(T2R38) (T2R138) (mT2R31)

Cleaved into:

GeneID:387513

Gene names  (primary ):Tas2r38

Gene names  (synonym ):T2r31 Tas2r138

Gene names  (ORF ):

Length:331

Mass:36966

Sequence:MLSLTPVLTVSYEAKISFLFLSAMEFAVGILANAFIVLVNVWDVVKKQPLNNCDIALLCLSITRLFLQGLLLLDAIQLACFQQMKDPLSHNYQAILTLWMIANQVSLWLAACLSLLYCSKIVRFSHTFPLHVASWVSRRFLQMLLVVLLLSCICTALCLWDFFCRSHSTVTSLLHLNSTEFSLQIAKLNFFYSFIFCNVGSVPPSLAFLVSSGVLVISLGSHMRTMKSQTSSSGDPSLEAHIRAIIFLISFFCFYVVSFCAALISIPLLMLWHNKGGVMICIGMMAACPSGHAAILISGNAKLRRAIETMLFWFQSRQKVRPVHKVPPRTL

Tissue specificity:Low levels in tongue, stomach and duodenum. {ECO:0000269|PubMed:15886333}.

Induction:

Developmental stage:

Protein families:G-protein coupled receptor T2R family


   💬 WhatsApp