TA2R3_MOUSE   Q7TQA7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q7TQA7

Recommended name:Taste receptor type 2 member 3

EC number:

Alternative names:(T2R3) (T2R137) (T2R37) (mT2r41)

Cleaved into:

GeneID:574417

Gene names  (primary ):Tas2r3

Gene names  (synonym ):T2r41 Tas2r137 Tas2r37

Gene names  (ORF ):

Length:316

Mass:36289

Sequence:MFGFIEGVFLVLTITEFILGNLVNGFIVSINSSYWFKSKKISLSNFIITSLALFRIFLLWIIFIDSLIIVFSYQTHDSGIMMQLIDVFWTFTNHFSIWLISCLSVFYCLKIASFSHPSFLWLKWRASRVVVGMLWGALLLSCVSTMSLMNEFKIYSALTRSKDTPNMTEYIRLKRQEYNLMHVLGNLWKIPSLIVSLVAYLLLLLSLGKHTQQMQQYSIDSRDQSAEAHKRAMRIISSFLLFFLFYFLSFMILSSSRFLPETRIARIIGVVISMSYLVGDSFILIVCNNKLKHTFVAMLPCECGHLKPGSKGPSAS

Tissue specificity:

Induction:

Developmental stage:

Protein families:G-protein coupled receptor T2R family


   💬 WhatsApp