TR129_MOUSE   Q7M709


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q7M709

Recommended name:Taste receptor type 2 member 129

EC number:

Alternative names:(T2R129) (mT2R60)

Cleaved into:

GeneID:387354

Gene names  (primary ):Tas2r129

Gene names  (synonym ):T2r60

Gene names  (ORF ):

Length:320

Mass:37178

Sequence:MDGIVQNMFTFIVIVEIIIGWIGNGFIALVNCIHWYKRRKISALNQILTALAFSRIYLLLTVFTVIAVSTLYTHVLVTRRVVKLINFHLLFSNHFSMWLAACLGLYYFLKIAHFPNSIFVYLKMRINQVVSGTLLMSLGLLFLNTLLINSYIDTKIDDYREHLLYDFTSNNTASFYRVILVINNCIFTSIPFTLSQSTFLLLIFSLWRHYKKMQQHAQRCRDVLADAHIRVLQTMVTYVLLCAIFFLSLSMQILRSELLKNILYVRFCEIVAAVFPSGHSCVLICRDTNLRGTFLSVLSWLKQRFTSWIPNINCRSSCIF

Tissue specificity:

Induction:

Developmental stage:

Protein families:G-protein coupled receptor T2R family


   💬 WhatsApp