TR120_MOUSE Q7M721
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q7M721
Recommended name：Taste receptor type 2 member 120
EC number：
Alternative names：(T2R120) (mT2R47)
Cleaved into：
GeneID：387348
Gene names (primary )：Tas2r120
Gene names (synonym )：T2r47
Gene names (ORF )：
Length：295
Mass：33594
Sequence：MNLVEWIVTIIMMTEFLLGNCANVFITIVNFIDCVKRRKISSADRIITAIAIFRIGLLWAMLTNWHSHVFTPDTDNLQMRVFGGITWAITNHFTTWLGTILSMFYLFKIANFSNSLFLHLKRKLDNVLLVIFLGSSLFLVAYLGMVNIKKIAWMSIHEGNVTTKSKLKHVTSITNMLLFSLINIVPFGISLNCVLLLIYSLSKHLKNMKFYGKGCQDQSTMVHIKALQTVVSFLLLYATYSSCVIISGWSLQNAPVFLFCVTIGSFYPAGHSCILIWGNQKLKQVFLLLLRQMRC
Tissue specificity：
Induction：
Developmental stage：
Protein families：G-protein coupled receptor T2R family