TR114_MOUSE Q7M722
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q7M722
Recommended name:Taste receptor type 2 member 114
EC number:
Alternative names:(T2R114) (mT2R46)
Cleaved into:
GeneID:387346
Gene names (primary ):Tas2r114
Gene names (synonym ):T2r46
Gene names (ORF ):
Length:309
Mass:35732
Sequence:MLSTMEGVLLSVSTSEAVLGIVGNTFIALVNCMDYNRNKKLSNIGFILTGLAISRICLVLILITEAYIKIFYPQLLSPVNIIELISYLWIIICQLNVWFATSLSIFYFLKIANFSHYIFVWLKRRIDLVFFFLIGCLLISWLFSFPVVAKMVKDNKMLYINTSWQIHMKKSELIINYVFTNGGVFLFFMIMLIVCFLLIISLWRHRRQMESNKLGFRDLNTEVHVRTIKVLLSFIILFILHFMGITINVICLLIPESNLLFMFGLTTAFIYPGCHSLILILANSRLKQCSVMILQLLKCCENGKELRDT
Tissue specificity:
Induction:
Developmental stage:
Protein families:G-protein coupled receptor T2R family