TR105_MOUSE Q9JKT4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JKT4
Recommended name：Taste receptor type 2 member 105
EC number：
Alternative names：(T2R105) (Taste receptor type 2 member 5) (T2R5) (Taste receptor type 2 member 9) (T2R9)
Cleaved into：
GeneID：57252
Gene names (primary )：Tas2r105
Gene names (synonym )：Tas2r5 Tas2r9
Gene names (ORF )：
Length：300
Mass：34416
Sequence：MLSAAEGILLSIATVEAGLGVLGNTFIALVNCMDWAKNNKLSMTGFLLIGLATSRIFIVWLLTLDAYAKLFYPSKYFSSSLIEIISYIWMTVNHLTVWFATSLSIFYFLKIANFSDCVFLWLKRRTDKAFVFLLGCLLTSWVISFSFVVKVMKDGKVNHRNRTSEMYWEKRQFTINYVFLNIGVISLFMMTLTACFLLIMSLWRHSRQMQSGVSGFRDLNTEAHVKAIKFLISFIILFVLYFIGVSIEIICIFIPENKLLFIFGFTTASIYPCCHSFILILSNSQLKQAFVKVLQGLKFF
Tissue specificity：Expressed in subsets of taste receptor cells of the tongue and palate epithelium and exclusively in gustducin-positive cells. Expressed in gastric and duodenal tissues.
Induction：
Developmental stage：
Protein families：G-protein coupled receptor T2R family