TR103_MOUSE Q9JKA3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JKA3
Recommended name：Taste receptor type 2 member 103
EC number：
Alternative names：(T2R103) (Taste receptor family B member 2) (TRB2) (Taste receptor type 2 member 10) (T2R10)
Cleaved into：
GeneID：667992
Gene names (primary )：Tas2r103
Gene names (synonym )：Tas2r10
Gene names (ORF )：
Length：312
Mass：35156
Sequence：MVLTIRAILWVTLITIISLEFIIGILGNVFIALVNIIDWVKRGKISAVDKTYMALAISRTAFLLSLITGFLVSLLDPALLGMRTMVRLLTISWMVTNHFSVWFATCLSIFYFLKIANFSNSIFLVLKWEAKKVVSVTLVVSVIILIMNIIVINKFTDRLQVNTLQNCSTSNTLKDYGLFLFISTGFTLTPFAVSLTMFLLLIFSLWRHLKNMCHSATGSRDVSTVAHIKGLQTVVTFLLLYTAFVMSLLSESLNINIQHTNLLSHFLRSIGVAFPTGHSCVLILGNSKLRQASLSVILWLRYKYKHIENWGP
Tissue specificity：Expressed in subsets of taste receptor cells of the tongue and palate epithelium and exclusively in gustducin-positive cells. Expressed in 15% taste bud cells in circumvallate and foliate papillae but only in 2% in fungiform papillae.
Induction：
Developmental stage：
Protein families：G-protein coupled receptor T2R family