SYT4_MOUSE   P40749


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P40749

Recommended name:Synaptotagmin-4

EC number:

Alternative names:(Synaptotagmin IV) (SytIV)

Cleaved into:

GeneID:20983

Gene names  (primary ):Syt4

Gene names  (synonym ):Syt3

Gene names  (ORF ):

Length:425

Mass:47659

Sequence:MAPITTSRVEFDEIPTVVGIFSAFGLVFTVSLFAWICCQRRSAKSNKTPPYKFVHVLKGVDIYPENLSSKKKFGGDDKSEVKGKAALPNLSLHLDLEKRDLNGNFPKANPKAGSSSDLENVTPKLFTETEKEANSPESLKSSTSLTSEEKQEKLGTLFLSLEYNFEKKAFVVNIKEAQGLPAMDEQSMTSDPYIKMTILPEKKHRVKTRVLRKTLDPVFDETFTFYGIPYPHIQELSLHFTVLSFDRFSRDDVIGEVLIPLSGIELSDGKMLMTREIIKRNAKKSSGRGELLVSLCYQSTTNTLTVVVLKARHLPKSDVSGLSDPYVKVNLYHAKKRISKKKTHVKKCTPNAVFNELFVFDIPCESLEEISVEFLVLDSERGSRNEVIGRLVLGATAEGSGGGHWKEICDFPRRQIAKWHMLCDG

Tissue specificity:Expressed in many regions of the nervous system but is undetectable in extra neural tissues (PubMed:8058779). {ECO:0000269|PubMed:8058779}.

Induction:

Developmental stage:

Protein families:Synaptotagmin family


   💬 WhatsApp