CYTB_MOUSE   Q62426


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q62426

Recommended name:Cystatin-B

EC number:

Alternative names:(Stefin-B)

Cleaved into:

GeneID:13014

Gene names  (primary ):Cstb

Gene names  (synonym ):Cst6 Stfb

Gene names  (ORF ):

Length:98

Mass:11046

Sequence:MMCGAPSATMPATAETQEVADQVKSQLESKENQKFDVFKAISFKRQIVAGTNLFIKVDVGGDKCVHLRVFQPLPHENKPLTLSSYQTNKERHDELSYF

Tissue specificity:Widely expressed. Highest expression in heart, liver and kidney. Lower levels in brain, lung and skeletal muscle. Lowest levels in spleen and testis.

Induction:

Developmental stage:

Protein families:Cystatin family


   💬 WhatsApp