ST4A1_MOUSE P63046
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P63046
Recommended name：Sulfotransferase 4A1
EC number：EC 2.8.2.-
Alternative names：(ST4A1) (Brain sulfotransferase-like protein) (mBR-STL) (Nervous system sulfotransferase) (NST)
Cleaved into：
GeneID：29859
Gene names (primary )：Sult4a1
Gene names (synonym )：Sultx3
Gene names (ORF )：
Length：284
Mass：33054
Sequence：MAESEAETPGTPGEFESKYFEFHGVRLPPFCRGKMEDIADFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSLRTMSYRGTFQEFCRRFMNDKLGYGSWFEHVQEFWEHRMDANVLFLKYEDMHRDLVTMVEQLARFLGVSCDKAQLESLIEHCHQLVDQCCNAEALPVGRGRVGLWKDIFTVSMNEKFDLVYKQKMGKCDLTFDFYL
Tissue specificity：Expressed in brain, cerebellum and hypothalamus. Not detected in pancreas, liver, lung, intestine, kidney, uterus, adrenal gland, thymus, spleen, epididymis, testicle, and heart. {ECO:0000269|PubMed:12039030}.
Induction：
Developmental stage：
Protein families：Sulfotransferase 1 family