ST1C2_MOUSE   Q9D939


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9D939

Recommended name:Sulfotransferase 1C2

EC number:EC 2.8.2.-

Alternative names:(ST1C2) (EC 2.8.2.-)

Cleaved into:

GeneID:69083

Gene names  (primary ):Sult1c2

Gene names  (synonym ):Sult1c1

Gene names  (ORF ):

Length:296

Mass:34953

Sequence:MALTPELSRQTKLKEVAGIPLQAPTVDNWRQIQTFEAKPDDLLICTYPKSGTTWIQEIVDMIEQNGDVEKCRRTIIQHRHPFIEWARPPQPSGVDKANEMPAPRILRTHLPTQLLPPSFWTNNCKFLYVARNAKDCMVSYYHFYRMSQVLPEPGTWDEYFETFINGKVSWGSWFDHVKGWWEIRDKYQILFLFYEDMKRNPKHEIQKVMQFMGKNLDEDVVDKIVLETSFEKMKENPMTNRSTAPKSILDQSISPFMRKGTVGDWKNHFTVAQNERFDEIYKQKMGRTSLNFSMEL

Tissue specificity:Highly expressed in stomach and kidney. {ECO:0000269|PubMed:12164856}.

Induction:

Developmental stage:

Protein families:Sulfotransferase 1 family


   💬 WhatsApp