SPSB3_MOUSE   Q571F5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q571F5

Recommended name:SPRY domain-containing SOCS box protein 3

EC number:

Alternative names:(SSB-3)

Cleaved into:

GeneID:79043

Gene names  (primary ):Spsb3

Gene names  (synonym ):Kiaa4204 Ssb3 Tce1

Gene names  (ORF ):

Length:354

Mass:39321

Sequence:MARRTRSSRAWHFVLSAARRDTDARAVALAGSSNWGYDSDGQHSDSDSDPEYSSLPPSIPSAVPVTGESFCDCEGQNEATFCNSLHTAHRGKDCRCGEEDEDFDWVWDDLNKSSATLLSCDNRKVSFHMEYSCGTAAIRGTKELGDGQHFWEIKMTSPVYGTDMMVGIGTSDVDLDKYHHTFCSLLGRDEDSWGLSYTGLLHHKGDKTSFSSRFGQGSIIGVHLDTWHGTLTFFKNRKCIGVAATRLQNRRFYPMVCSTAAKSSMKVIRSCASSTSLQYLCCYRLRQLRPNSGDTLEGLPLPPGLKQVLHNKLGWVLSMNCNHWKSPVPPPGTATPGAESLETRPCQRKRCRRS

Tissue specificity:

Induction:

Developmental stage:

Protein families:SPSB family


   💬 WhatsApp