SPP2B_MOUSE   Q3TD49


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q3TD49

Recommended name:Signal peptide peptidase-like 2B

EC number:EC 3.4.23.-

Alternative names:(SPP-like 2B) (SPPL2b) (EC 3.4.23.-)

Cleaved into:

GeneID:73218

Gene names  (primary ):Sppl2b

Gene names  (synonym ):

Gene names  (ORF ):

Length:578

Mass:63824

Sequence:MAAARLAAALLLLAAQVACEFGVLRVVSQTSRTRSRDYCILYNPQWAHLPHDLSKVSLLKLRDLSTTQLCSYLDVPAEDFTNQIALVARGNCTFYEKVRLAQGSGAHGLLIVSKEKLVPPGGNKTQYEEISIPVALLSHRDLQDIFRRFGREVMVALYAPSEPVMDYNMVIIFVMAVGTVAIGGYWAGSHDVKKYMKHKRDDGPEKQEDEAVDVTPVMICVFVVMCCFMLVLLYYFYDRLVYVIIGIFCLASSTGLYSCLAPFVRKLPFCTCRVPDNNLPYFHKRPQARMLLLALFCVTVSVVWGIFRNEDQWAWVLQDTLGIAFCLYMLKTIRLPTFKACTLLLLVLFIYDIFFVFITPFLTKSGNSIMVEVATGPSNSSTHEKLPMVLKVPRLNTSPLSLCDRPFSLLGFGDILVPGLLVAYCHRFDIQVQSSRIYFVACTIAYGLGLLVTFVALVLMQRGQPALLYLVPCTLLTSCTVALWRRELGAFWTGSGFAKDAPQTPWAATQGPVPPKAVGSSLSEQPPSEELAKSPLSTEEAGAADPAKDPDNPVASPLSPSNGDEAQPIPVVKPETSA

Tissue specificity:

Induction:

Developmental stage:

Protein families:Peptidase A22B family


   💬 WhatsApp