YLAT1_MOUSE Q9Z1K8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9Z1K8
Recommended name：Y+L amino acid transporter 1
EC number：
Alternative names：(Solute carrier family 7 member 7) (y(+)L-type amino acid transporter 1) (Y+LAT1) (y+LAT-1)
Cleaved into：
GeneID：20540
Gene names (primary )：Slc7a7
Gene names (synonym )：
Gene names (ORF )：
Length：510
Mass：55677
Sequence：MVNSTKYEVAAQHEADDGSALGDGASPVAEQVKLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLMYSASFGLSLVIWAVGGIFSVFGALCYAELGTTIKKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAVIAITFANYMVQPLFPSCGAPYAAGRLLAAACICLLTFINCAYVKWGTLVQDIFTYAKVLALIAVIIAGIVRLGQGATANFENSFEGSSFAMGDIALALYSALFSYSGWDTLNYVTEEIRNPERNLPLSIGISMPIVTIIYLLTNVAYYSVLDIKEILASDAVAVTFADQIFGVFNWIIPVAVAFSCFGGLNASIVAASRLLFVGSREGHLPDAICMVHVERFTPVPSLLFNGVLSLVYLCVEDIFQLINYYSFSYWFFVGLSIVGQLYLRWKDPDRPRPLKLSLFFPIIFCLCTIFLVAVPLYSDTINSLIGIGIALSGLPFYFFIIRVPEHKRPLFLRRIVASITRYLQILCMSVAAEMDLEDGELSKQDPKSK
Tissue specificity：Strongly expressed in kidney and intestine. Weaker expression observed in epididymis, testis, ovary, thyroid pancreas, sub-gland and liver. {ECO:0000269|PubMed:9878049}.
Induction：
Developmental stage：
Protein families：Amino acid-polyamine-organocation (APC) superfamily, L-type amino acid transporter (LAT) (TC 2.A.3.8) family