S38A9_MOUSE   Q8BGD6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BGD6

Recommended name:Sodium-coupled neutral amino acid transporter 9

EC number:

Alternative names:(Solute carrier family 38 member 9)

Cleaved into:

GeneID:268706

Gene names  (primary ):Slc38a9

Gene names  (synonym ):

Gene names  (ORF ):

Length:560

Mass:63392

Sequence:MASVDGDSRHLLSEVEHEVSPGPMNIQFDSSDLRSKRPFYIEPTNIVNVNDVIQRVSDHAAAMNKRIHYYSRLTTPADKALIAPDHVVPAPEECYVYSPLGSAYKLKSYTEGYGKNTSLVTIFMIWNTMMGTSILSIPWGIKQAGFTTGMCVIVLMGLLTLYCCYRVVKSRSTISTSDTSTWEYPDVCKHYFGSFGQWSSLLFSLVSLIGAMIVYWVLMSNFLFNTGKFIFNFIHHINDTDTVLSTNNSNPVICPNAGSGGRPDNSSMIFYNNNTEVQLFEKWWDKSRTVPFYLIGLLLPLLNFKSPSFFSKFNILGTVSVLYLIFVVTLKAVRLGFHLEFHWFVPTEFFVPEIRAQFPQLMGVLTLAFFIHNCIITLLKNNKNQENNVRDLCIAYMLVTLTYLYIGILVFASFPSPPLPKDCIEQNFLDNFPSSDILSFIARIFLLFQMMTVYPLLGYLARVQLLGHIFGDIYPSIFHVLILNLVIVGAGVTMACFYPNIGGIIRYSGAACGLAFVFIYPSLIYIISLHQEERLTWPKLVFHVIIIILGLANLIAQFFM

Tissue specificity:

Induction:

Developmental stage:

Protein families:Amino acid/polyamine transporter 2 family, SLC38A9 subfamily


   💬 WhatsApp