S38A7_MOUSE Q8BWH0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BWH0
Recommended name：Putative sodium-coupled neutral amino acid transporter 7
EC number：
Alternative names：(Solute carrier family 38 member 7)
Cleaved into：
GeneID：234595
Gene names (primary )：Slc38a7
Gene names (synonym )：Snat7
Gene names (ORF )：
Length：463
Mass：49913
Sequence：MAQVSINSDYSEWASSTDAGERARLLQSPCVDVVPKSEGEASPGDPDSGTTSTLGAVFIVVNACLGAGLLNFPAAFSTAGGVAAGIALQMGMLVFIISGLVILAYCSQASNERTYQEVVWAVCGKLTGVLCEVAIAVYTFGTCIAFLIIIGDQQDKIIAVMSKEPDGASGSPWYTDRKFTISLTAFLFILPLSIPKEIGFQKYASFLSVVGTWYVTAIIIIKYIWPDKEMRPGDILTRPASWMAVFNAMPTICFGFQCHVSSVPVFNSMRQPEVKTWGGVVTAAMVIALAVYMGTGICGFLTFGAAVDPDVLRSYPSEDVAVAVARAFIILSVLTSYPILHFCGRAVVEGLWLRYKGMPVEEDVGRERRRRVLQTLVWFLLTLLLALFIPDIGKVISVIGGLAACFIFIFPGLCLIQAKLSEMEEVKPASWWALVSYGVLLVTLGAFIFGQTTANAIFVDLLA
Tissue specificity：Highly expressed in the brain, including the hippocampus, especially in the granular layer of dentate gyrus cells and the pyramidal cell layer of the hippocampus, amygdala, thalamus, hypothalamus, in the layer of Purkinje cells in the cerebellum and the layers of cortex. Particularly strong expression in neurons of the ventromedial hypothalamus, basolateral amygdala, ventral tegmental area, and locus coeruleus. Not detected in glial cells, including astrocytes. In addition to brain, also expressed in the spinal cord (at protein level). {ECO:0000269|PubMed:21511949}.
Induction：
Developmental stage：
Protein families：Amino acid/polyamine transporter 2 family