FUCT1_MOUSE   Q8BLX4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BLX4

Recommended name:GDP-fucose transporter 1

EC number:

Alternative names:(Solute carrier family 35 member C1)

Cleaved into:

GeneID:228368

Gene names  (primary ):Slc35c1

Gene names  (synonym ):Fuct1

Gene names  (ORF ):

Length:363

Mass:39967

Sequence:MNRAPLKRSRILRMALTGVSAVSEESESGNKPFLLRALQIALVVSLYWVTSISMVFLNKYLLDSPSLQLDTPIFVTFYQCLVTSLLCKGLSTLATCCPGMVDFPTLNLDLKVARSVLPLSVVFIGMITFNNLCLKYVGVPFYNVGRSLTTVFNVLLSYLLLKQTTSFYALLTCGVIIGGFWLGIDQEGAEGTLSLTGTIFGVLASLCVSLNAIYTKKVLPAVDHSIWRLTFYNNVNACVLFLPLMIVLGELRALLAFTHLSSAHFWLMMTLGGLFGFAIGYVTGLQIKFTSPLTHNVSGTAKACAQTVLAVLYYEEIKSFLWWTSNLMVLGGSSAYTWVRGWEMQKTQEDPSSKDGEKSAIRV

Tissue specificity:

Induction:

Developmental stage:

Protein families:TPT transporter family, SLC35C subfamily


   💬 WhatsApp