S35B4_MOUSE   Q8CIA5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8CIA5

Recommended name:UDP-xylose and UDP-N-acetylglucosamine transporter

EC number:

Alternative names:(Solute carrier family 35 member B4)

Cleaved into:

GeneID:58246

Gene names  (primary ):Slc35b4

Gene names  (synonym ):

Gene names  (ORF ):MNCb-4414

Length:331

Mass:37517

Sequence:MRPAFAVGLVFAGCCSNVIFLELLARTHPGCGNIVTFAQFLFIAVEGFLFEANLGRKPPAIPIRYYAIMVTMFFTVSVVNNYALNLNIAMPLHMIFRSGSLIANMILGIIILKKRYSMFKYTSIALVSAGIFICTFMSAKQVTVQTGLSDKDGFQAFAWWLLGIAALTFALLMSARMGIFQETLYRQFGKHSKEALFYNHALPLPGFIFLASDIYDHVVLFNKSELYQVPVIGVTMPVMWFYLLMNVVTQYVCIRGVFILTTECTSLTVTLVVTLRKFVSLIFSILYFQNQFTMWHWLGTSFVFIGTLMYTEVWKNLGTTKSELQKDDKKD

Tissue specificity:

Induction:

Developmental stage:

Protein families:Nucleotide-sugar transporter family, SLC35B subfamily


   💬 WhatsApp