S2542_MOUSE   Q8R0Y8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8R0Y8

Recommended name:Mitochondrial coenzyme A transporter SLC25A42

EC number:

Alternative names:(Solute carrier family 25 member 42)

Cleaved into:

GeneID:73095

Gene names  (primary ):Slc25a42

Gene names  (synonym ):

Gene names  (ORF ):

Length:318

Mass:35241

Sequence:MGNGVQEGSVRLREDAEAVLAGAVSSKRDHRQVLSSLLSGALAGALAKTAVAPLDRTKIIFQVSSKRFSAKEAFRLLYFTYLNEGFLSLWRGNSATMVRVIPYAAIQFSAHEEYKRILGHYYGFRGEALPPWPRLLAGALAGTTAASLTYPLDLVRARMAVTPKEMYSNIFHVFIRISREEGLKTLYFGFTPTVLGVIPYAGLSFFTYESLKSLHREYSGRPQPYPFERMVFGACAGLIGQSASYPLDVVRRRMQTAGVTGHQHGSILSTLRSIVREEGAVRGLYKGLSMNWLKGPIAVGISFTTFDLMQILLRRLQS

Tissue specificity:

Induction:

Developmental stage:

Protein families:Mitochondrial carrier (TC 2.A.29) family


   💬 WhatsApp