S2538_MOUSE Q91XD8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q91XD8
Recommended name：Mitochondrial glycine transporter
EC number：
Alternative names：(Solute carrier family 25 member 38)
Cleaved into：
GeneID：208638
Gene names (primary )：Slc25a38
Gene names (synonym )：
Gene names (ORF )：
Length：326
Mass：35390
Sequence：MGVSAEPRSLSVAGAGLASPVIEKARSALLQSQDVEDTVETLMLHPVIKAFLCGSISGTCSTLLFQPLDLLKTRLQALQPSDLGPRRVGMLAVFLKVVRTESLLGLWKGMSPSIVRCVPGVGIYFGTLYSSKQYFLRGHPPTALESVILGMGSRSVAGVCMSPITVIKTRYESGTYSYESIYAALRSIYCSEGHRGLFRGLTATLLRDAPFSGLYLMFYSQTRTAVLHGTAQLDAALIPLINFSCGIFAGVLASLVTQPADVIKTHMQLSPVKFQWIGQAATLIFKNHGLRGFFHGSVPRALRRTLMAAMAWTVYEEMMARMGLKS
Tissue specificity：
Induction：
Developmental stage：
Protein families：Mitochondrial carrier (TC 2.A.29) family, SLC25A38 subfamily