SO1A1_MOUSE   Q9QXZ6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9QXZ6

Recommended name:Solute carrier organic anion transporter family member 1A1

EC number:

Alternative names:(Sodium-independent organic anion-transporting polypeptide 1) (OATP-1) (Solute carrier family 21 member 1)

Cleaved into:

GeneID:28248

Gene names  (primary ):Slco1a1

Gene names  (synonym ):Oatp1a1 Slc21a1

Gene names  (ORF ):

Length:670

Mass:74396

Sequence:MEETEKKVATQEGRFFSKMKVFLMSLTCAYLAKSLSGVYMNSMLTQIERQFGIPTSVVGFITGSFEIGNLLLIVFVSYFGRKLHRPIIIGVGCVVMGLGCFLMASPHFLMGRYKYETTISPTSNLSSNSFLCIENRTQTLKPTQDPTECVKEIKSLMWIYVLIGNTMRGIGETPIMPLGISYIEDFAKSENSPLYIGILEMGKIVGPIIGLLLGSFFARVYVDIGSVNTDDLTITPTDTRWVGAWWIGFLVCAGVNILTSIPFFFFPKTLPKKELQDNVDVTKYEKVEKHRERAKKENLGITKDFLPFMKSLCCNPIYMLFSLTSVLQINGFASTFTFLPKYLEQQYGKSTSEAVFLIGVYSLPPVCLGYLISGFIMKKFKITVKKAAYIAFGLSLSEYFIFLCNYLLTCDNFPVAGLTTSYKGVQHPLYGEKNVLADCNTRCSCLTDTWDPVCGDNGLAYMSACLAGCEKSVGTGTNMVFQNCSCIGSSGNSSAVLGLCKKGPECDNKLQYFLIKSVFSSFIFSLAAIPGYMVLLRCVKSEEKSIGVGLHAFFIRLLAGIPAPVYFGALIDRTCLHWGTLKCGQPGACRMYDINRFRHIYLGLPAAVRGSSFLPAVFILILMRKFHFPGDIHSPDTELAEMKLTEKESECTDVCRSPKVENDGELKTKL

Tissue specificity:Highly expressed in liver, and at lower levels in kidney. Not detected in other tissues.

Induction:

Developmental stage:

Protein families:Organo anion transporter (TC 2.A.60) family


   💬 WhatsApp