S7A13_MOUSE Q91WN3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q91WN3
Recommended name：Solute carrier family 7 member 13
EC number：
Alternative names：(Sodium-independent aspartate/glutamate transporter 1) (X-amino acid transporter 2)
Cleaved into：
GeneID：74087
Gene names (primary )：Slc7a13
Gene names (synonym )：Agt1 Xat2
Gene names (ORF )：
Length：478
Mass：53233
Sequence：MAMDSKKEIRLKRELGYFWGTNFLIINIIGAGIFVSPKGVLQHSSMNVGVSLCVWAVCAVLTLTSALCSAEIGITFPYSGAHYYFLKRCFGPLVAFLRLWTSLFLGPGLIASQALLLAEYGVQPFYPSCSAPILPRKCLALAMLWIVGILNSRGVKELSWLQTVSSVLKVGILGVISLSGLFLLVRGKKENVQRLQNAFDAEFPEVSQLIEAIFQGYFAFSGGGCFTCIAGELKKPSKTIPRCIFTGLPLVTVVYLLANISYLTVLTPQEMLSSDAVALTWTDRVIPQFTWTVPFAISASLFINLVINVLETSRVLYIASENGQLPLLFCALNVHSSPFIAVLLIISMASILIVLTNLIDLINYLYFVVSIWTALSIIGILKLRYQEPNLHRPYKVFLPFTFIALGITLSLVLIPLVKSPKLHYIYVFLFLLSGLVFYVPLIHFKVKFVWFQKLTCYLQLLFNICIPDVSDDHIHEES
Tissue specificity：Expressed in the kidney. {ECO:0000269|PubMed:11907033, ECO:0000269|PubMed:11943479}.
Induction：
Developmental stage：
Protein families：Amino acid-polyamine-organocation (APC) superfamily