AT1B1_MOUSE P14094
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P14094
Recommended name：Sodium/potassium-transporting ATPase subunit beta-1
EC number：
Alternative names：(Sodium/potassium-dependent ATPase subunit beta-1)
Cleaved into：
GeneID：11931
Gene names (primary )：Atp1b1
Gene names (synonym )：Atp4b
Gene names (ORF )：
Length：304
Mass：35195
Sequence：MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISELKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIIRFLEKYKDSAQKDDMIFEDCGNVPSEPKERGDINHERGERKVCRFKLDWLGNCSGLNDDSYGYREGKPCIIIKLNRVLGFKPKPPKNESLETYPLMMKYNPNVLPVQCTGKRDEDKDKVGNIEYFGMGGYYGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTVDTEIRVECKAYGENIGYSEKDRFQGRFDVKIEIKS
Tissue specificity：Expressed in cardiac muscle and in flexor digitorum brevis (FDB) muscle (at protein level) (PubMed:23392350). Expressed in a circadian manner in the kidney and aorta (at protein level) (PubMed:30012868). {ECO:0000269|PubMed:23392350, ECO:0000269|PubMed:30012868}.
Induction：
Developmental stage：
Protein families：X(+)/potassium ATPases subunit beta family